PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma76g00080.1
Common NameZOSMA_76G00080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 189aa    MW: 22114.4 Da    PI: 8.2114
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma76g00080.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF75.44.5e-241058250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     ri+n +++q tf kRr g++KKA+ELSvLCda+ ++i+fs+tgklye+ 
  Zosma76g00080.1 10 RIDNPIQKQSTFYKRRDGLFKKAKELSVLCDANLLLILFSTTGKLYEFH 58
                     8***********************************************6 PP

2K-box24.21.4e-0976169598
            K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      ++++ +     + + e ++ ++  + L++e+R l  +d +  s+  L +Le+ Le+s++k+R+ K++ + +++ +l ++   ++ee++ L +kl
  Zosma76g00080.1  76 THTQIWCDSLLERNAEKERFEQLCHGLETELRFLRVDDEQCYSVPALGRLERTLEDSVNKVRAEKYRKIEAEMGRLENMVLHHDEEKNFLCQKL 169
                      555566666677788999999999999999999999999999************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.978161IPR002100Transcription factor, MADS-box
SMARTSM004324.0E-32160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.97E-27383IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-23323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-201057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-233859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.60385175IPR002487Transcription factor, K-box
PfamPF014861.4E-889169IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MVRGKMQIRR IDNPIQKQST FYKRRDGLFK KAKELSVLCD ANLLLILFST TGKLYEFHSP  60
SFSSSKEFIR KYETATHTQI WCDSLLERNA EKERFEQLCH GLETELRFLR VDDEQCYSVP  120
ALGRLERTLE DSVNKVRAEK YRKIEAEMGR LENMVLHHDE EKNFLCQKLG NVEMNKDAAM  180
LDLKLGFN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009416444.14e-67PREDICTED: MADS-box transcription factor 32-like
SwissprotQ8S1516e-63MAD32_ORYSJ; MADS-box transcription factor 32
TrEMBLA0A0K9NPA91e-138A0A0K9NPA9_Z
STRINGGSMUA_Achr9P05780_0018e-65(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP119233439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.11e-27MIKC_MADS family protein